Lineage for d2fcwb1 (2fcw B:86-124)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890850Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 890851Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 890852Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 890862Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 890863Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries)
    Uniprot P01130 272-353
  8. 890864Domain d2fcwb1: 2fcw B:86-124 [133289]
    Other proteins in same PDB: d2fcwa1
    automatically matched to d1n7da6
    complexed with ca, mpd, na; mutant

Details for d2fcwb1

PDB Entry: 2fcw (more details), 1.26 Å

PDB Description: structure of a complex between the pair of the ldl receptor ligand- binding modules 3-4 and the receptor associated protein (rap).
PDB Compounds: (B:) low-density lipoprotein receptor

SCOP Domain Sequences for d2fcwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
ktcsqaefrchdgkcisrqfvcdsdrdcldgsdeascpv

SCOP Domain Coordinates for d2fcwb1:

Click to download the PDB-style file with coordinates for d2fcwb1.
(The format of our PDB-style files is described here.)

Timeline for d2fcwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fcwb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fcwa1