Class g: Small proteins [56992] (90 folds) |
Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
Superfamily g.12.1: LDL receptor-like module [57424] (1 family) |
Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries) Uniprot P01130 272-353 |
Domain d2fcwb1: 2fcw B:86-124 [133289] Other proteins in same PDB: d2fcwa1 automatically matched to d1n7da6 complexed with ca, mpd, na; mutant |
PDB Entry: 2fcw (more details), 1.26 Å
SCOP Domain Sequences for d2fcwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} ktcsqaefrchdgkcisrqfvcdsdrdcldgsdeascpv
Timeline for d2fcwb1: