SCOPe 2.01: Domain d2fcwa1: 2fcw A:216-320

Lineage for d2fcwa1 (2fcw A:216-320)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.13: RAP domain-like [47044] (1 superfamily)
   3 helices, the first one is shorter than the other two; bundle, partly opened

4. Superfamily a.13.1: RAP domain-like [47045] (1 family)

5. Family a.13.1.1: RAP domain [47046] (1 protein)

6. Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)

8. Domain d2fcwa1: 2fcw A:216-320 [133288]
   Other proteins in same PDB: d2fcwb1, d2fcwb2
   3rd RAP domain
   complexed with ca, mpd, na

Details for d2fcwa1

PDB Entry: 2fcw, 1.26 Å

PDB Description: structure of a complex between the pair of the ldl receptor ligand- binding modules 3-4 and the receptor associated protein (rap).

PDB Compounds: (A:) Alpha-2-macroglobulin receptor-associated protein

SCOPe Domain Sequences for d2fcwa1:

Sequence; same for both SEQRES and ATOM records:

>d2fcwa1 a.13.1.1 (A:216-320) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
aefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqleiaheklrhae
svgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarh

Timeline for d2fcwa1:

• d2fcwa1 first appeared in SCOP 1.73
  
• d2fcwa1 appears in SCOP 1.75
  
• d2fcwa1 appears in SCOPe 2.02
  
• d2fcwa1 appears in the current release, SCOPe 2.08