![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.13: RAP domain-like [47044] (1 superfamily) 3 helices, the first one is shorter than the other two; bundle, partly opened |
![]() | Superfamily a.13.1: RAP domain-like [47045] (1 family) ![]() |
![]() | Family a.13.1.1: RAP domain [47046] (1 protein) |
![]() | Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries) |
![]() | Domain d2fcwa1: 2fcw A:216-320 [133288] Other proteins in same PDB: d2fcwb1, d2fcwb2 3rd RAP domain complexed with ca, mpd, na |
PDB Entry: 2fcw (more details), 1.26 Å
SCOPe Domain Sequences for d2fcwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcwa1 a.13.1.1 (A:216-320) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]} aefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqleiaheklrhae svgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarh
Timeline for d2fcwa1: