Lineage for d2fcwa1 (2fcw A:216-320)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637204Fold a.13: RAP domain-like [47044] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, partly opened
  4. 637205Superfamily a.13.1: RAP domain-like [47045] (1 family) (S)
  5. 637206Family a.13.1.1: RAP domain [47046] (1 protein)
  6. 637207Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)
  7. 637208Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)
  8. 637209Domain d2fcwa1: 2fcw A:216-320 [133288]
    Other proteins in same PDB: d2fcwb1, d2fcwb2
    3rd RAP domain
    complexed with ca, mpd, na; mutant

Details for d2fcwa1

PDB Entry: 2fcw (more details), 1.26 Å

PDB Description: structure of a complex between the pair of the ldl receptor ligand- binding modules 3-4 and the receptor associated protein (rap).
PDB Compounds: (A:) Alpha-2-macroglobulin receptor-associated protein

SCOP Domain Sequences for d2fcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcwa1 a.13.1.1 (A:216-320) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
aefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqleiaheklrhae
svgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarh

SCOP Domain Coordinates for d2fcwa1:

Click to download the PDB-style file with coordinates for d2fcwa1.
(The format of our PDB-style files is described here.)

Timeline for d2fcwa1: