Lineage for d2fcvb_ (2fcv B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071025Family b.82.2.9: PhyH-like [141623] (3 protein domains)
    Pfam PF05721
  6. 2071029Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species)
  7. 2071030Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries)
    Uniprot Q9RBY6 3-310
  8. 2071036Domain d2fcvb_: 2fcv B: [133287]
    automated match to d2fcta1
    complexed with akg, br, dsu, fe2

Details for d2fcvb_

PDB Entry: 2fcv (more details), 1.8 Å

PDB Description: SyrB2 with Fe(II), bromide, and alpha-ketoglutarate
PDB Compounds: (B:) syringomycin biosynthesis enzyme 2

SCOPe Domain Sequences for d2fcvb_:

Sequence, based on SEQRES records: (download)

>d2fcvb_ b.82.2.9 (B:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
kfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggtni
anydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfan
asgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdan
nsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsge
sqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttr
gkkfeav

Sequence, based on observed residues (ATOM records): (download)

>d2fcvb_ b.82.2.9 (B:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
kfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdnianydrhld
ddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasgkpqii
wpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsvvkdgv
rrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqemrmgf
asryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkkfeav

SCOPe Domain Coordinates for d2fcvb_:

Click to download the PDB-style file with coordinates for d2fcvb_.
(The format of our PDB-style files is described here.)

Timeline for d2fcvb_: