Lineage for d2fcub1 (2fcu B:3-310)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810188Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 810346Family b.82.2.9: PhyH-like [141623] (2 proteins)
    Pfam PF05721
  6. 810350Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species)
  7. 810351Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries)
    Uniprot Q9RBY6 3-310
  8. 810355Domain d2fcub1: 2fcu B:3-310 [133285]
    automatically matched to 2FCT A:3-310
    complexed with akg, dsu

Details for d2fcub1

PDB Entry: 2fcu (more details), 1.6 Å

PDB Description: SyrB2 with alpha-ketoglutarate
PDB Compounds: (B:) syringomycin biosynthesis enzyme 2

SCOP Domain Sequences for d2fcub1:

Sequence, based on SEQRES records: (download)

>d2fcub1 b.82.2.9 (B:3-310) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggtn
ianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfa
nasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepda
nnsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsg
esqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthtt
rgkkfeav

Sequence, based on observed residues (ATOM records): (download)

>d2fcub1 b.82.2.9 (B:3-310) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldtnianyd
rhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasgk
pqiiwpfggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsvvkdgv
rrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqemrmgf
asryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkkfeav

SCOP Domain Coordinates for d2fcub1:

Click to download the PDB-style file with coordinates for d2fcub1.
(The format of our PDB-style files is described here.)

Timeline for d2fcub1: