![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.9: PhyH-like [141623] (3 proteins) Pfam PF05721 |
![]() | Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species) |
![]() | Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries) Uniprot Q9RBY6 3-310 |
![]() | Domain d2fcub_: 2fcu B: [133285] Other proteins in same PDB: d2fcua3 automated match to d2fcta1 complexed with akg, dsu |
PDB Entry: 2fcu (more details), 1.6 Å
SCOPe Domain Sequences for d2fcub_:
Sequence, based on SEQRES records: (download)
>d2fcub_ b.82.2.9 (B:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]} kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggtn ianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfa nasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepda nnsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsg esqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthtt rgkkfeav
>d2fcub_ b.82.2.9 (B:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]} kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldtnianyd rhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasgk pqiiwpfggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsvvkdgv rrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqemrmgf asryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkkfeav
Timeline for d2fcub_: