Lineage for d2fcua_ (2fcu A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425172Family b.82.2.9: PhyH-like [141623] (3 proteins)
    Pfam PF05721
  6. 2425176Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species)
  7. 2425177Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries)
    Uniprot Q9RBY6 3-310
  8. 2425180Domain d2fcua_: 2fcu A: [133284]
    automated match to d2fcta1
    complexed with akg, dsu

Details for d2fcua_

PDB Entry: 2fcu (more details), 1.6 Å

PDB Description: SyrB2 with alpha-ketoglutarate
PDB Compounds: (A:) syringomycin biosynthesis enzyme 2

SCOPe Domain Sequences for d2fcua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcua_ b.82.2.9 (A:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
skkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggt
nianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtf
anasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepd
annsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphs
gesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvtht
trgkkfeav

SCOPe Domain Coordinates for d2fcua_:

Click to download the PDB-style file with coordinates for d2fcua_.
(The format of our PDB-style files is described here.)

Timeline for d2fcua_: