SCOPe 2.07: Domain d2fcua_: 2fcu A:

Lineage for d2fcua_ (2fcu A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.9: PhyH-like [141623] (3 proteins)
   Pfam PF05721

6. Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species)

7. Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries)
   Uniprot Q9RBY6 3-310

8. Domain d2fcua_: 2fcu A: [133284]
   automated match to d2fcta1
   complexed with akg, dsu

Details for d2fcua_

PDB Entry: 2fcu, 1.6 Å

PDB Description: SyrB2 with alpha-ketoglutarate

PDB Compounds: (A:) syringomycin biosynthesis enzyme 2

SCOPe Domain Sequences for d2fcua_:

Sequence; same for both SEQRES and ATOM records:

>d2fcua_ b.82.2.9 (A:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
skkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggt
nianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtf
anasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepd
annsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphs
gesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvtht
trgkkfeav

Timeline for d2fcua_:

• d2fcua_ first appeared in SCOP 1.73, called d2fcua1
  
• d2fcua_ appears in SCOPe 2.06
  
• d2fcua_ appears in the current release, SCOPe 2.08, called d2fcua2