Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.9: PhyH-like [141623] (3 proteins) Pfam PF05721 |
Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species) |
Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries) Uniprot Q9RBY6 3-310 |
Domain d2fcua_: 2fcu A: [133284] automated match to d2fcta1 complexed with akg, dsu |
PDB Entry: 2fcu (more details), 1.6 Å
SCOPe Domain Sequences for d2fcua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcua_ b.82.2.9 (A:) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]} skkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggt nianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtf anasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepd annsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphs gesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvtht trgkkfeav
Timeline for d2fcua_: