![]() | Class k: Designed proteins [58788] (44 folds) |
![]() | Fold k.45: Ubiquitin [144344] (1 superfamily) |
![]() | Superfamily k.45.1: Ubiquitin [144345] (1 family) ![]() |
![]() | Family k.45.1.1: Ubiquitin [144346] (1 protein) |
![]() | Protein Ubiquitin [144347] (1 species) |
![]() | Species Synthetic [144348] (6 PDB entries) |
![]() | Domain d2fcsa1: 2fcs A:1-59 [133280] Other proteins in same PDB: d2fcsa2, d2fcsb2 automatically matched to 1YJ1 A:1-71 complexed with act, cd, so4 |
PDB Entry: 2fcs (more details), 1.8 Å
SCOPe Domain Sequences for d2fcsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcsa1 k.45.1.1 (A:1-59) Ubiquitin {Synthetic} lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdy
Timeline for d2fcsa1: