Lineage for d2fcsa1 (2fcs A:1-59)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048432Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 3048433Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 3048434Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 3048435Protein Ubiquitin [144347] (1 species)
  7. 3048436Species Synthetic [144348] (6 PDB entries)
  8. 3048443Domain d2fcsa1: 2fcs A:1-59 [133280]
    Other proteins in same PDB: d2fcsa2, d2fcsb2
    automatically matched to 1YJ1 A:1-71
    complexed with act, cd, so4

Details for d2fcsa1

PDB Entry: 2fcs (more details), 1.8 Å

PDB Description: x-ray crystal structure of a chemically synthesized [l-gln35]ubiquitin with a cubic space group
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d2fcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcsa1 k.45.1.1 (A:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdy

SCOPe Domain Coordinates for d2fcsa1:

Click to download the PDB-style file with coordinates for d2fcsa1.
(The format of our PDB-style files is described here.)

Timeline for d2fcsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fcsa2