Lineage for d2fcnb1 (2fcn B:1-59)

  1. Root: SCOPe 2.07
  2. 2652352Class k: Designed proteins [58788] (44 folds)
  3. 2652972Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 2652973Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 2652974Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 2652975Protein Ubiquitin [144347] (1 species)
  7. 2652976Species Synthetic [144348] (6 PDB entries)
  8. 2652986Domain d2fcnb1: 2fcn B:1-59 [133277]
    Other proteins in same PDB: d2fcna2, d2fcnb2
    automatically matched to 2FCN A:1-73
    complexed with act, cd

Details for d2fcnb1

PDB Entry: 2fcn (more details), 2.2 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-val35]ubiquitin with a cubic space group
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2fcnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcnb1 k.45.1.1 (B:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdy

SCOPe Domain Coordinates for d2fcnb1:

Click to download the PDB-style file with coordinates for d2fcnb1.
(The format of our PDB-style files is described here.)

Timeline for d2fcnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fcnb2