SCOP 1.73: Domain d2fcnb1: 2fcn B:1-73

Lineage for d2fcnb1 (2fcn B:1-73)

1. Root: SCOP 1.73

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.45: Ubiquitin [144344] (1 superfamily)

4. Superfamily k.45.1: Ubiquitin [144345] (1 family)

5. Family k.45.1.1: Ubiquitin [144346] (1 protein)

6. Protein Ubiquitin [144347] (1 species)

7. Species synthetic [144348] (6 PDB entries)

8. Domain d2fcnb1: 2fcn B:1-73 [133277]
   automatically matched to 2FCN A:1-73

Details for d2fcnb1

PDB Entry: 2fcn, 2.2 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-val35]ubiquitin with a cubic space group

PDB Compounds: (B:) Ubiquitin

SCOP Domain Sequences for d2fcnb1:

Sequence; same for both SEQRES and ATOM records:

>d2fcnb1 k.45.1.1 (B:1-73) Ubiquitin {synthetic}
lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrl

Timeline for d2fcnb1:

• d2fcnb1 is new in SCOP 1.73
  
• d2fcnb1 appears in SCOP 1.75
  
• d2fcnb1 appears in the current release, SCOPe 2.08