Lineage for d2fcna1 (2fcn A:1-73)

  1. Root: SCOPe 2.05
  2. 1975766Class k: Designed proteins [58788] (44 folds)
  3. 1976383Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 1976384Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 1976385Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 1976386Protein Ubiquitin [144347] (1 species)
  7. 1976387Species Synthetic [144348] (6 PDB entries)
  8. 1976396Domain d2fcna1: 2fcn A:1-73 [133276]
    complexed with act, cd

Details for d2fcna1

PDB Entry: 2fcn (more details), 2.2 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-val35]ubiquitin with a cubic space group
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d2fcna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcna1 k.45.1.1 (A:1-73) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrl

SCOPe Domain Coordinates for d2fcna1:

Click to download the PDB-style file with coordinates for d2fcna1.
(The format of our PDB-style files is described here.)

Timeline for d2fcna1: