SCOPe 2.07: Domain d2fcla1: 2fcl A:2-157

Lineage for d2fcla1 (2fcl A:2-157)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.11: TM1012-like [143239] (2 proteins)
   insert X in the core is an alpha-beta(2) unit; contains extra C-terminal structures; mixed 7-stranded sheet, order: 6712543;

6. Protein Hypothetical protein TM1012 [143240] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [143241] (2 PDB entries)
   Uniprot Q9X0A5 1-157! Uniprot Q9X0A5 2-157

8. Domain d2fcla1: 2fcl A:2-157 [133273]
   Other proteins in same PDB: d2fcla2
   complexed with edo, unl

Details for d2fcla1

PDB Entry: 2fcl, 1.2 Å

PDB Description: Crystal structure of a putative nucleotidyltransferase (tm1012) from Thermotoga maritima at 1.35 A resolution

PDB Compounds: (A:) hypothetical protein TM1012

SCOPe Domain Sequences for d2fcla1:

Sequence; same for both SEQRES and ATOM records:

>d2fcla1 d.218.1.11 (A:2-157) Hypothetical protein TM1012 {Thermotoga maritima [TaxId: 2336]}
irpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierifs
efvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfveth
gmkipvlsleyeyqaylklgrvekaetlrkwlnerk

Timeline for d2fcla1:

• d2fcla1 first appeared in SCOP 1.73
  
• d2fcla1 appears in SCOPe 2.06
  
• d2fcla1 appears in the current release, SCOPe 2.08