Lineage for d2fcla1 (2fcl A:2-157)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007324Family d.218.1.11: TM1012-like [143239] (2 proteins)
    insert X in the core is an alpha-beta(2) unit; contains extra C-terminal structures; mixed 7-stranded sheet, order: 6712543;
  6. 3007325Protein Hypothetical protein TM1012 [143240] (1 species)
  7. 3007326Species Thermotoga maritima [TaxId:2336] [143241] (2 PDB entries)
    Uniprot Q9X0A5 1-157! Uniprot Q9X0A5 2-157
  8. 3007327Domain d2fcla1: 2fcl A:2-157 [133273]
    Other proteins in same PDB: d2fcla2
    complexed with edo, unl

Details for d2fcla1

PDB Entry: 2fcl (more details), 1.2 Å

PDB Description: Crystal structure of a putative nucleotidyltransferase (tm1012) from Thermotoga maritima at 1.35 A resolution
PDB Compounds: (A:) hypothetical protein TM1012

SCOPe Domain Sequences for d2fcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcla1 d.218.1.11 (A:2-157) Hypothetical protein TM1012 {Thermotoga maritima [TaxId: 2336]}
irpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierifs
efvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfveth
gmkipvlsleyeyqaylklgrvekaetlrkwlnerk

SCOPe Domain Coordinates for d2fcla1:

Click to download the PDB-style file with coordinates for d2fcla1.
(The format of our PDB-style files is described here.)

Timeline for d2fcla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fcla2