Lineage for d2fcka1 (2fck A:1-178)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533536Protein Putative ribosomal-protein-serine acetyltransferase VC1889 [143684] (1 species)
    similar to RimL and RimJ
  7. 2533537Species Vibrio cholerae [TaxId:666] [143685] (1 PDB entry)
    Uniprot Q9KQV9 1-178
  8. 2533538Domain d2fcka1: 2fck A:1-178 [133272]
    complexed with gol, no3

Details for d2fcka1

PDB Entry: 2fck (more details), 1.7 Å

PDB Description: structure of a putative ribosomal-protein-serine acetyltransferase from vibrio cholerae.
PDB Compounds: (A:) ribosomal-protein-serine acetyltransferase, putative

SCOPe Domain Sequences for d2fcka1:

Sequence, based on SEQRES records: (download)

>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}
mtpdfqivtqrlqlrlitadeaeelvqcirqsqtlhqwvdwchalfsqqeaeqfiqatrl
nwvkaeaygfgvferqtqtlvgmvainefyhtfnmaslgywigdryqrqgygkealtali
lfcferleltrleivcdpenvpsqalalrcganreqlapnrflyagepkagivfslip

Sequence, based on observed residues (ATOM records): (download)

>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}
mtpdfqivtqrlqlrlitadeaeelvqcirqsqtlhqwvdwfsqqeaeqfiqatrlnwvk
aeaygfgvferqtqtlvgmvainefyhtfnmaslgywigdryqrqgygkealtalilfcf
erleltrleivcdpenvpsqalalrcganreqlapnrflyagepkagivfslip

SCOPe Domain Coordinates for d2fcka1:

Click to download the PDB-style file with coordinates for d2fcka1.
(The format of our PDB-style files is described here.)

Timeline for d2fcka1: