SCOPe 2.07: Domain d2fcjc_: 2fcj C:

Lineage for d2fcjc_ (2fcj C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)

5. Family c.136.1.1: Toprim domain [110456] (3 proteins)
   Pfam PF01751

6. Protein Hypothetical protein RBSTP2199 [142016] (1 species)
   B. subtilis YusF homolog

7. Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry)
   Uniprot Q5KVJ9 1-114

8. Domain d2fcjc_: 2fcj C: [133271]
   automated match to d2fcja1
   complexed with gol, mes, so4

Details for d2fcjc_

PDB Entry: 2fcj, 1.3 Å

PDB Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.

PDB Compounds: (C:) small TOPRIM domain protein

SCOPe Domain Sequences for d2fcjc_:

Sequence; same for both SEQRES and ATOM records:

>d2fcjc_ c.136.1.1 (C:) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
rvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladadea
geklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrg

Timeline for d2fcjc_:

• d2fcjc_ first appeared in SCOP 1.73, called d2fcjc1
  
• d2fcjc_ appears in SCOPe 2.06
  
• d2fcjc_ appears in the current release, SCOPe 2.08