Lineage for d2fcjc1 (2fcj C:3-114)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713599Fold c.136: Toprim domain [110454] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 713600Superfamily c.136.1: Toprim domain [110455] (1 family) (S)
    this domain is also present in several multidomain proteins that are not split in scop yet: scop_sf 56712, scop_sf 56719, scop_sf 56726, scop_sf 56731
  5. 713601Family c.136.1.1: Toprim domain [110456] (2 proteins)
    Pfam PF01751
  6. 713606Protein Hypothetical protein RBSTP2199 [142016] (1 species)
    B. subtilis YusF homolog
  7. 713607Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry)
  8. 713610Domain d2fcjc1: 2fcj C:3-114 [133271]
    automatically matched to 2FCJ A:1-114
    complexed with gol, mes, so4

Details for d2fcjc1

PDB Entry: 2fcj (more details), 1.3 Å

PDB Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.
PDB Compounds: (C:) small TOPRIM domain protein

SCOP Domain Sequences for d2fcjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcjc1 c.136.1.1 (C:3-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
rvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladadea
geklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm

SCOP Domain Coordinates for d2fcjc1:

Click to download the PDB-style file with coordinates for d2fcjc1.
(The format of our PDB-style files is described here.)

Timeline for d2fcjc1: