Lineage for d2fcjb_ (2fcj B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530594Fold c.136: Toprim domain [110454] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2530595Superfamily c.136.1: Toprim domain [110455] (1 family) (S)
    this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)
  5. 2530596Family c.136.1.1: Toprim domain [110456] (3 proteins)
    Pfam PF01751
  6. 2530601Protein Hypothetical protein RBSTP2199 [142016] (1 species)
    B. subtilis YusF homolog
  7. 2530602Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry)
    Uniprot Q5KVJ9 1-114
  8. 2530604Domain d2fcjb_: 2fcj B: [133270]
    automated match to d2fcja1
    complexed with gol, mes, so4

Details for d2fcjb_

PDB Entry: 2fcj (more details), 1.3 Å

PDB Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.
PDB Compounds: (B:) small TOPRIM domain protein

SCOPe Domain Sequences for d2fcjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcjb_ c.136.1.1 (B:) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
rrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladade
ageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge

SCOPe Domain Coordinates for d2fcjb_:

Click to download the PDB-style file with coordinates for d2fcjb_.
(The format of our PDB-style files is described here.)

Timeline for d2fcjb_: