SCOP 1.73: Domain d2fcjb1: 2fcj B:2-114

Lineage for d2fcjb1 (2fcj B:2-114)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: scop_sf 56712, scop_sf 56719, scop_sf 56726, scop_sf 56731

5. Family c.136.1.1: Toprim domain [110456] (2 proteins)
   Pfam PF01751

6. Protein Hypothetical protein RBSTP2199 [142016] (1 species)
   B. subtilis YusF homolog

7. Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry)

8. Domain d2fcjb1: 2fcj B:2-114 [133270]
   automatically matched to 2FCJ A:1-114
   complexed with gol, mes, so4

Details for d2fcjb1

PDB Entry: 2fcj, 1.3 Å

PDB Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.

PDB Compounds: (B:) small TOPRIM domain protein

SCOP Domain Sequences for d2fcjb1:

Sequence; same for both SEQRES and ATOM records:

>d2fcjb1 c.136.1.1 (B:2-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
rrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladade
ageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm

Timeline for d2fcjb1:

• d2fcjb1 is new in SCOP 1.73
  
• d2fcjb1 appears in SCOP 1.75
  
• d2fcjb1 appears in the current release, SCOPe 2.08, called d2fcjb_