SCOPe 2.08: Domain d2fcjb_: 2fcj B:

Lineage for d2fcjb_ (2fcj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)

5. Family c.136.1.1: Toprim domain [110456] (3 proteins)
   Pfam PF01751

6. Protein Hypothetical protein RBSTP2199 [142016] (1 species)
   B. subtilis YusF homolog

7. Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry)
   Uniprot Q5KVJ9 1-114

8. Domain d2fcjb_: 2fcj B: [133270]
   automated match to d2fcja1
   complexed with gol, mes, so4

Details for d2fcjb_

PDB Entry: 2fcj, 1.3 Å

PDB Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.

PDB Compounds: (B:) small TOPRIM domain protein

SCOPe Domain Sequences for d2fcjb_:

Sequence; same for both SEQRES and ATOM records:

>d2fcjb_ c.136.1.1 (B:) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
rrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladade
ageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge

Timeline for d2fcjb_:

• d2fcjb_ first appeared in SCOP 1.73, called d2fcjb1
  
• d2fcjb_ appears in SCOPe 2.07