Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.136: Toprim domain [110454] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.136.1: Toprim domain [110455] (1 family) this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731) |
Family c.136.1.1: Toprim domain [110456] (3 proteins) Pfam PF01751 |
Protein Hypothetical protein RBSTP2199 [142016] (1 species) B. subtilis YusF homolog |
Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry) Uniprot Q5KVJ9 1-114 |
Domain d2fcjb_: 2fcj B: [133270] automated match to d2fcja1 complexed with gol, mes, so4 |
PDB Entry: 2fcj (more details), 1.3 Å
SCOPe Domain Sequences for d2fcjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcjb_ c.136.1.1 (B:) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]} rrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladade ageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
Timeline for d2fcjb_: