Lineage for d2fcja1 (2fcj A:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923405Fold c.136: Toprim domain [110454] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2923406Superfamily c.136.1: Toprim domain [110455] (1 family) (S)
    this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)
  5. 2923407Family c.136.1.1: Toprim domain [110456] (3 proteins)
    Pfam PF01751
  6. 2923412Protein Hypothetical protein RBSTP2199 [142016] (1 species)
    B. subtilis YusF homolog
  7. 2923413Species Bacillus stearothermophilus [TaxId:1422] [142017] (1 PDB entry)
    Uniprot Q5KVJ9 1-114
  8. 2923414Domain d2fcja1: 2fcj A:1-114 [133269]
    complexed with gol, mes, so4

Details for d2fcja1

PDB Entry: 2fcj (more details), 1.3 Å

PDB Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.
PDB Compounds: (A:) small TOPRIM domain protein

SCOPe Domain Sequences for d2fcja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcja1 c.136.1.1 (A:1-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad
eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm

SCOPe Domain Coordinates for d2fcja1:

Click to download the PDB-style file with coordinates for d2fcja1.
(The format of our PDB-style files is described here.)

Timeline for d2fcja1: