Lineage for d2fcfa1 (2fcf A:1148-1243)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395592Protein Multiple PDZ domain protein [141267] (1 species)
  7. 2395593Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
    Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
  8. 2395594Domain d2fcfa1: 2fcf A:1148-1243 [133267]
    Other proteins in same PDB: d2fcfa2, d2fcfa3
    PDZ 7

Details for d2fcfa1

PDB Entry: 2fcf (more details), 1.76 Å

PDB Description: The crystal structure of the 7th PDZ domain of MPDZ (MUPP-1)
PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2fcfa1:

Sequence, based on SEQRES records: (download)

>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
qprrvelwrepskslgisivggrgmgsrlsngevmrgifikhvledspagkngtlkpgdr
ivevdgmdlrdasheqaveairkagnpvvfmvqsii

Sequence, based on observed residues (ATOM records): (download)

>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
qprrvelwrepkslgisivggrgifikhvledspagkngtlkpgdrivevdgmdlrdash
eqaveairkagnpvvfmvqsii

SCOPe Domain Coordinates for d2fcfa1:

Click to download the PDB-style file with coordinates for d2fcfa1.
(The format of our PDB-style files is described here.)

Timeline for d2fcfa1: