SCOPe 2.04: Domain d2fcea_: 2fce A:

Lineage for d2fcea_ (2fce A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (4 PDB entries)

8. Domain d2fcea_: 2fce A: [133266]
   automated match to d1xfxo1

Details for d2fcea_

PDB Entry: 2fce

PDB Description: solution structure of c-lobe myosin light chain from saccharomices cerevisiae

PDB Compounds: (A:) myosin light chain 1

SCOPe Domain Sequences for d2fcea_:

Sequence; same for both SEQRES and ATOM records:

>d2fcea_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaktedfvkafqvfdkestgkvsvgdlrymltglgekltdaevdellkgvevdsngeidy
kkfiedvlrq

Timeline for d2fcea_:

• d2fcea_ first appeared in SCOP 1.73, called d2fcea1
  
• d2fcea_ was called d2fcea1 in SCOPe 2.03
  
• d2fcea_ appears in SCOPe 2.05
  
• d2fcea_ appears in the current release, SCOPe 2.08