Lineage for d2fccb1 (2fcc B:2-138)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637322Fold a.18: T4 endonuclease V [47076] (1 superfamily)
    3 helices; irregular array
  4. 637323Superfamily a.18.1: T4 endonuclease V [47077] (1 family) (S)
  5. 637324Family a.18.1.1: T4 endonuclease V [47078] (1 protein)
  6. 637325Protein T4 endonuclease V [47079] (1 species)
  7. 637326Species Bacteriophage T4 [TaxId:10665] [47080] (6 PDB entries)
  8. 637333Domain d2fccb1: 2fcc B:2-138 [133265]
    automatically matched to d2end__
    complexed with bru, gol, ped, so4

Details for d2fccb1

PDB Entry: 2fcc (more details), 2.3 Å

PDB Description: Crystal Structure of T4 Pyrimidine Dimer Glycosylase (T4-Pdg) Covalently Complexed with a DNA Substrate Containing Abasic Site
PDB Compounds: (B:) endonuclease v

SCOP Domain Sequences for d2fccb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fccb1 a.18.1.1 (B:2-138) T4 endonuclease V {Bacteriophage T4 [TaxId: 10665]}
trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya

SCOP Domain Coordinates for d2fccb1:

Click to download the PDB-style file with coordinates for d2fccb1.
(The format of our PDB-style files is described here.)

Timeline for d2fccb1: