Lineage for d2fcca_ (2fcc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311231Fold a.18: T4 endonuclease V [47076] (1 superfamily)
    3 helices; irregular array
  4. 2311232Superfamily a.18.1: T4 endonuclease V [47077] (1 family) (S)
    automatically mapped to Pfam PF03013
  5. 2311233Family a.18.1.1: T4 endonuclease V [47078] (1 protein)
  6. 2311234Protein T4 endonuclease V [47079] (1 species)
  7. 2311235Species Bacteriophage T4 [TaxId:10665] [47080] (6 PDB entries)
  8. 2311240Domain d2fcca_: 2fcc A: [133264]
    automated match to d2end__
    protein/DNA complex; complexed with gol, so4

Details for d2fcca_

PDB Entry: 2fcc (more details), 2.3 Å

PDB Description: Crystal Structure of T4 Pyrimidine Dimer Glycosylase (T4-Pdg) Covalently Complexed with a DNA Substrate Containing Abasic Site
PDB Compounds: (A:) endonuclease v

SCOPe Domain Sequences for d2fcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcca_ a.18.1.1 (A:) T4 endonuclease V {Bacteriophage T4 [TaxId: 10665]}
trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya

SCOPe Domain Coordinates for d2fcca_:

Click to download the PDB-style file with coordinates for d2fcca_.
(The format of our PDB-style files is described here.)

Timeline for d2fcca_: