![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.53: TrmB-like [142647] (1 protein) Pfam PF02390 |
![]() | Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142650] (1 PDB entry) |
![]() | Domain d2fcab1: 2fca B:11-213 [133263] automatically matched to 2FCA A:10-213 complexed with k |
PDB Entry: 2fca (more details), 2.1 Å
SCOP Domain Sequences for d2fcab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcab1 c.66.1.53 (B:11-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} dflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigiel fksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekrrl tyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegnim teyeekfsalgqpiyraevewrt
Timeline for d2fcab1: