Lineage for d2fcab1 (2fca B:11-213)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705313Family c.66.1.53: TrmB-like [142647] (1 protein)
    Pfam PF02390
  6. 705314Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)
  7. 705315Species Bacillus subtilis [TaxId:1423] [142650] (1 PDB entry)
  8. 705317Domain d2fcab1: 2fca B:11-213 [133263]
    automatically matched to 2FCA A:10-213
    complexed with k

Details for d2fcab1

PDB Entry: 2fca (more details), 2.1 Å

PDB Description: the structure of bstrmb
PDB Compounds: (B:) tRNA (guanine-N(7)-)-methyltransferase

SCOP Domain Sequences for d2fcab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcab1 c.66.1.53 (B:11-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}
dflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigiel
fksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekrrl
tyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegnim
teyeekfsalgqpiyraevewrt

SCOP Domain Coordinates for d2fcab1:

Click to download the PDB-style file with coordinates for d2fcab1.
(The format of our PDB-style files is described here.)

Timeline for d2fcab1: