SCOPe 2.07: Domain d2fcab_: 2fca B:

Lineage for d2fcab_ (2fca B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.53: TrmB-like [142647] (1 protein)
   Pfam PF02390

6. Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142650] (1 PDB entry)
   Uniprot O34522 10-213

8. Domain d2fcab_: 2fca B: [133263]
   automated match to d2fcaa1
   complexed with k

Details for d2fcab_

PDB Entry: 2fca, 2.1 Å

PDB Description: the structure of bstrmb

PDB Compounds: (B:) tRNA (guanine-N(7)-)-methyltransferase

SCOPe Domain Sequences for d2fcab_:

Sequence; same for both SEQRES and ATOM records:

>d2fcab_ c.66.1.53 (B:) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}
dflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigiel
fksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekrrl
tyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegnim
teyeekfsalgqpiyraevewrt

Timeline for d2fcab_:

• d2fcab_ first appeared in SCOP 1.73, called d2fcab1
  
• d2fcab_ appears in SCOPe 2.06