SCOP 1.73: Domain d2fcaa1: 2fca A:10-213

Lineage for d2fcaa1 (2fca A:10-213)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.53: TrmB-like [142647] (1 protein)
   Pfam PF02390

6. Protein tRNA (guanine-N(7)-)-methyltransferase TrmB [142648] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142650] (1 PDB entry)

8. Domain d2fcaa1: 2fca A:10-213 [133262]
   complexed with k

Details for d2fcaa1

PDB Entry: 2fca, 2.1 Å

PDB Description: the structure of bstrmb

PDB Compounds: (A:) tRNA (guanine-N(7)-)-methyltransferase

SCOP Domain Sequences for d2fcaa1:

Sequence; same for both SEQRES and ATOM records:

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}
ddflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigie
lfksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekrr
ltyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegni
mteyeekfsalgqpiyraevewrt

Timeline for d2fcaa1:

• d2fcaa1 is new in SCOP 1.73
  
• d2fcaa1 appears in SCOP 1.75
  
• d2fcaa1 appears in the current release, SCOPe 2.08