SCOPe 2.01: Domain d2fc1a_: 2fc1 A:

Lineage for d2fc1a_ (2fc1 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Bacillus subtilis [TaxId:1423] [82822] (5 PDB entries)

8. Domain d2fc1a_: 2fc1 A: [133261]
   automated match to d1m7va_
   complexed with arg, hbi, hem, no

Details for d2fc1a_

PDB Entry: 2fc1, 2 Å

PDB Description: Heme NO Complex in NOS

PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2fc1a_:

Sequence; same for both SEQRES and ATOM records:

>d2fc1a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]}
gshmeilwneakafiaecyqelgkeeevkdrldsikseidrtgsyvhtkeelehgakmaw
rnsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekge
kqveiwnhqliryagyegerigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqp
vwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgt
eigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdh
htaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkpy
e

Timeline for d2fc1a_:

• d2fc1a_ first appeared in SCOP 1.73, called d2fc1a1
  
• d2fc1a_ was called d2fc1a1 in SCOP 1.75
  
• d2fc1a_ appears in SCOPe 2.02
  
• d2fc1a_ appears in the current release, SCOPe 2.08, called d2fc1a2