SCOPe 2.06: Domain d2fbqa2: 2fbq A:81-214

Lineage for d2fbqa2 (2fbq A:81-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Transcriptional regulator PsrA [140901] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140902] (1 PDB entry)
   Uniprot Q9HZJ9 81-214

8. Domain d2fbqa2: 2fbq A:81-214 [133257]
   Other proteins in same PDB: d2fbqa1

Details for d2fbqa2

PDB Entry: 2fbq, 1.8 Å

PDB Description: the crystal structure of transcriptional regulator pa3006

PDB Compounds: (A:) probable transcriptional regulator

SCOPe Domain Sequences for d2fbqa2:

Sequence; same for both SEQRES and ATOM records:

>d2fbqa2 a.121.1.1 (A:81-214) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]}
aqhatledllhllvsqamavkprsgndlsifmrllglafsqsqghlrkyleevygkvfrr
ymllvneaapklppielfwrvhfmlgaaafsmsgikalramaetdfgvntsteqvmhlmv
pffaagmraesgid

Timeline for d2fbqa2:

• d2fbqa2 first appeared in SCOP 1.73
  
• d2fbqa2 appears in SCOPe 2.05
  
• d2fbqa2 appears in SCOPe 2.07
  
• d2fbqa2 appears in the current release, SCOPe 2.08