Lineage for d2fbqa2 (2fbq A:81-214)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Transcriptional regulator PsrA [140901] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [140902] (1 PDB entry)
Uniprot Q9HZJ9 81-214
Domain d2fbqa2: 2fbq A:81-214 [133257]
Other proteins in same PDB: d2fbqa1
Details for d2fbqa2
PDB Entry: 2fbq (more details), 1.8 Å
PDB Description: the crystal structure of transcriptional regulator pa3006
PDB Compounds: (A:) probable transcriptional regulatorSCOPe Domain Sequences for d2fbqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbqa2 a.121.1.1 (A:81-214) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]}
aqhatledllhllvsqamavkprsgndlsifmrllglafsqsqghlrkyleevygkvfrr
ymllvneaapklppielfwrvhfmlgaaafsmsgikalramaetdfgvntsteqvmhlmv
pffaagmraesgid
SCOPe Domain Coordinates for d2fbqa2:
Click to download the PDB-style file with coordinates for d2fbqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fbqa2:
- d2fbqa2 first appeared in SCOP 1.73
- d2fbqa2 appears in SCOPe 2.07
View in 3D
