SCOPe 2.08: Domain d2fbqa1: 2fbq A:2-80

Lineage for d2fbqa1 (2fbq A:2-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional regulator PsrA [140205] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140206] (1 PDB entry)
   Uniprot Q9HZJ9 2-80

8. Domain d2fbqa1: 2fbq A:2-80 [133256]
   Other proteins in same PDB: d2fbqa2

Details for d2fbqa1

PDB Entry: 2fbq, 1.8 Å

PDB Description: the crystal structure of transcriptional regulator pa3006

PDB Compounds: (A:) probable transcriptional regulator

SCOPe Domain Sequences for d2fbqa1:

Sequence; same for both SEQRES and ATOM records:

>d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]}
aqsetverildaaeqlfaekgfaetslrlitskagvnlaavnyhfgskkaliqavfsrfl
gpfcaslekeldrrqakpe

Timeline for d2fbqa1:

• d2fbqa1 first appeared in SCOP 1.73
  
• d2fbqa1 appears in SCOPe 2.07