![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Transcriptional regulator PsrA [140205] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140206] (1 PDB entry) Uniprot Q9HZJ9 2-80 |
![]() | Domain d2fbqa1: 2fbq A:2-80 [133256] Other proteins in same PDB: d2fbqa2 |
PDB Entry: 2fbq (more details), 1.8 Å
SCOPe Domain Sequences for d2fbqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} aqsetverildaaeqlfaekgfaetslrlitskagvnlaavnyhfgskkaliqavfsrfl gpfcaslekeldrrqakpe
Timeline for d2fbqa1: