Lineage for d2fbna1 (2fbn A:22-174)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333890Protein Putative 70 kda peptidylprolyl isomerase PFL2275c [140841] (1 species)
  7. 2333891Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [140842] (1 PDB entry)
    Uniprot Q8I4V8 128-280
  8. 2333892Domain d2fbna1: 2fbn A:22-174 [133254]

Details for d2fbna1

PDB Entry: 2fbn (more details), 1.63 Å

PDB Description: Plasmodium falciparum putative FK506-binding protein PFL2275c, C-terminal TPR-containing domain
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putative

SCOPe Domain Sequences for d2fbna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
akksiydytdeekvqsafdikeegneffkkneineaivkykealdffihteewddqilld
kkknieiscnlnlatcynknkdypkaidhaskvlkidknnvkalyklgvanmyfgfleea
kenlykaaslnpnnldirnsyelcvnklkeark

SCOPe Domain Coordinates for d2fbna1:

Click to download the PDB-style file with coordinates for d2fbna1.
(The format of our PDB-style files is described here.)

Timeline for d2fbna1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fbnb_