SCOPe 2.05: Domain d2fbmc_: 2fbm C:

Lineage for d2fbmc_ (2fbm C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry)
   Uniprot Q9Y6F8 282-532

8. Domain d2fbmc_: 2fbm C: [133253]
   automated match to d2fbma1
   complexed with cl

Details for d2fbmc_

PDB Entry: 2fbm, 2.28 Å

PDB Description: Acetyltransferase domain of CDY1

PDB Compounds: (C:) Y chromosome chromodomain protein 1, telomeric isoform b

SCOPe Domain Sequences for d2fbmc_:

Sequence; same for both SEQRES and ATOM records:

>d2fbmc_ c.14.1.3 (C:) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc
cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlki

Timeline for d2fbmc_:

• d2fbmc_ first appeared in SCOP 1.73, called d2fbmc1
  
• d2fbmc_ appears in SCOPe 2.04
  
• d2fbmc_ appears in SCOPe 2.06
  
• d2fbmc_ appears in the current release, SCOPe 2.08