Lineage for d2fbmc_ (2fbm C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835691Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 1835751Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species)
  7. 1835752Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry)
    Uniprot Q9Y6F8 282-532
  8. 1835755Domain d2fbmc_: 2fbm C: [133253]
    automated match to d2fbma1
    complexed with cl

Details for d2fbmc_

PDB Entry: 2fbm (more details), 2.28 Å

PDB Description: Acetyltransferase domain of CDY1
PDB Compounds: (C:) Y chromosome chromodomain protein 1, telomeric isoform b

SCOPe Domain Sequences for d2fbmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbmc_ c.14.1.3 (C:) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc
cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlki

SCOPe Domain Coordinates for d2fbmc_:

Click to download the PDB-style file with coordinates for d2fbmc_.
(The format of our PDB-style files is described here.)

Timeline for d2fbmc_: