![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry) Uniprot Q9Y6F8 282-532 |
![]() | Domain d2fbmc_: 2fbm C: [133253] automated match to d2fbma1 complexed with cl |
PDB Entry: 2fbm (more details), 2.28 Å
SCOPe Domain Sequences for d2fbmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbmc_ c.14.1.3 (C:) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss aqgiesmlki
Timeline for d2fbmc_: