Lineage for d2fbmc1 (2fbm C:283-532)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 981011Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 981074Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species)
  7. 981075Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry)
    Uniprot Q9Y6F8 282-532
  8. 981078Domain d2fbmc1: 2fbm C:283-532 [133253]
    automatically matched to 2FBM A:282-532
    complexed with cl

Details for d2fbmc1

PDB Entry: 2fbm (more details), 2.28 Å

PDB Description: Acetyltransferase domain of CDY1
PDB Compounds: (C:) Y chromosome chromodomain protein 1, telomeric isoform b

SCOPe Domain Sequences for d2fbmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbmc1 c.14.1.3 (C:283-532) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc
cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlki

SCOPe Domain Coordinates for d2fbmc1:

Click to download the PDB-style file with coordinates for d2fbmc1.
(The format of our PDB-style files is described here.)

Timeline for d2fbmc1: