SCOP 1.73: Domain d2fbmc1: 2fbm C:283-532

Lineage for d2fbmc1 (2fbm C:283-532)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry)

8. Domain d2fbmc1: 2fbm C:283-532 [133253]
   automatically matched to 2FBM A:282-532
   complexed with cl

Details for d2fbmc1

PDB Entry: 2fbm, 2.28 Å

PDB Description: Acetyltransferase domain of CDY1

PDB Compounds: (C:) Y chromosome chromodomain protein 1, telomeric isoform b

SCOP Domain Sequences for d2fbmc1:

Sequence; same for both SEQRES and ATOM records:

>d2fbmc1 c.14.1.3 (C:283-532) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc
cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlki

Timeline for d2fbmc1:

• d2fbmc1 is new in SCOP 1.73
  
• d2fbmc1 appears in SCOP 1.75
  
• d2fbmc1 appears in the current release, SCOPe 2.08, called d2fbmc_