Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry) Uniprot Q9Y6F8 282-532 |
Domain d2fbma1: 2fbm A:282-532 [133251] complexed with cl |
PDB Entry: 2fbm (more details), 2.28 Å
SCOPe Domain Sequences for d2fbma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbma1 c.14.1.3 (A:282-532) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tyrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvf ccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilpl cdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakgl vsqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiws saqgiesmlki
Timeline for d2fbma1: