SCOPe 2.02: Domain d2fbma1: 2fbm A:282-532

Lineage for d2fbma1 (2fbm A:282-532)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein Chromodomain protein CDY1, C-terminal domain [142008] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142009] (1 PDB entry)
   Uniprot Q9Y6F8 282-532

8. Domain d2fbma1: 2fbm A:282-532 [133251]
   complexed with cl

Details for d2fbma1

PDB Entry: 2fbm, 2.28 Å

PDB Description: Acetyltransferase domain of CDY1

PDB Compounds: (A:) Y chromosome chromodomain protein 1, telomeric isoform b

SCOPe Domain Sequences for d2fbma1:

Sequence; same for both SEQRES and ATOM records:

>d2fbma1 c.14.1.3 (A:282-532) Chromodomain protein CDY1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tyrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvf
ccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilpl
cdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakgl
vsqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiws
saqgiesmlki

Timeline for d2fbma1:

• d2fbma1 first appeared in SCOP 1.73
  
• d2fbma1 appears in SCOPe 2.01
  
• d2fbma1 appears in SCOPe 2.03
  
• d2fbma1 appears in the current release, SCOPe 2.08