SCOPe 2.06: Domain d2fbkb_: 2fbk B:

Lineage for d2fbkb_ (2fbk B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (6 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [187697] (2 PDB entries)

8. Domain d2fbkb_: 2fbk B: [133248]
   Other proteins in same PDB: d2fbka1
   automated match to d2fbka1
   complexed with cl

Details for d2fbkb_

PDB Entry: 2fbk, 2.3 Å

PDB Description: the crystal structure of hucr from deinococcus radiodurans

PDB Compounds: (B:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d2fbkb_:

Sequence, based on SEQRES records:

>d2fbkb_ a.4.5.28 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
dtaallerirsdwarlnhgqgpdsdgltpsagpmltllllerlhaalgreiertyaasgl
naagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierrederdrrs
asirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleq

Sequence, based on observed residues (ATOM records):

>d2fbkb_ a.4.5.28 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
dtaallerirsdwarlnhgpsagpmltllllerlhaalgreiertyaasglnaagwdlll
tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl
lpahlattqrvlaplsaqeqrtleelagrmlagleq

Timeline for d2fbkb_:

• d2fbkb_ first appeared in SCOP 1.73, called d2fbkb1
  
• d2fbkb_ appears in SCOPe 2.05
  
• d2fbkb_ appears in SCOPe 2.07
  
• d2fbkb_ appears in the current release, SCOPe 2.08