Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (19 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Transcriptional regulator DR1159 [140255] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [140256] (1 PDB entry) Uniprot Q9RV71 8-179 |
Domain d2fbkb1: 2fbk B:8-179 [133248] automatically matched to 2FBK A:8-179 complexed with cl |
PDB Entry: 2fbk (more details), 2.3 Å
SCOP Domain Sequences for d2fbkb1:
Sequence, based on SEQRES records: (download)
>d2fbkb1 a.4.5.28 (B:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} dtaallerirsdwarlnhgqgpdsdgltpsagpmltllllerlhaalgreiertyaasgl naagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierrederdrrs asirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleq
>d2fbkb1 a.4.5.28 (B:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} dtaallerirsdwarlnhgpsagpmltllllerlhaalgreiertyaasglnaagwdlll tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl lpahlattqrvlaplsaqeqrtleelagrmlagleq
Timeline for d2fbkb1: