SCOPe 2.08: Domain d2fbka1: 2fbk A:8-179

Lineage for d2fbka1 (2fbk A:8-179)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator DR1159 [140255] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [140256] (1 PDB entry)
   Uniprot Q9RV71 8-179

8. Domain d2fbka1: 2fbk A:8-179 [133247]
   Other proteins in same PDB: d2fbkb_
   complexed with cl

Details for d2fbka1

PDB Entry: 2fbk, 2.3 Å

PDB Description: the crystal structure of hucr from deinococcus radiodurans

PDB Compounds: (A:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d2fbka1:

Sequence, based on SEQRES records:

>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]}
dtaallerirsdwarlnhgqgpdsdgltpsagpmltllllerlhaalgreiertyaasgl
naagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierrederdrrs
asirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleq

Sequence, based on observed residues (ATOM records):

>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]}
dtaallerirsdwarlnhgpsagpmltllllerlhaalgreiertyaasglnaagwdlll
tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl
lpahlattqrvlaplsaqeqrtleelagrmlagleq

Timeline for d2fbka1:

• d2fbka1 first appeared in SCOP 1.73
  
• d2fbka1 appears in SCOPe 2.07