![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Probable transcriptional regulator PA4135 [140245] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140246] (1 PDB entry) Uniprot Q9HWP6 5-140 |
![]() | Domain d2fbia1: 2fbi A:5-140 [133246] |
PDB Entry: 2fbi (more details), 2.1 Å
SCOPe Domain Sequences for d2fbia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} rpsltltllqareaamsffrpslnqhglteqqwrvirilrqqgemesyqlanqacilrps mtgvlarlerdgivrrwkapkdqrrvyvnltekgqqcfvsmsgdmeknyqriqerfgeek laqllellnelkkikp
Timeline for d2fbia1: