Lineage for d2fbia1 (2fbi A:5-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693760Protein Probable transcriptional regulator PA4135 [140245] (1 species)
  7. 2693761Species Pseudomonas aeruginosa [TaxId:287] [140246] (1 PDB entry)
    Uniprot Q9HWP6 5-140
  8. 2693762Domain d2fbia1: 2fbi A:5-140 [133246]

Details for d2fbia1

PDB Entry: 2fbi (more details), 2.1 Å

PDB Description: the crystal structure of transcriptional regulator pa4135
PDB Compounds: (A:) probable transcriptional regulator

SCOPe Domain Sequences for d2fbia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]}
rpsltltllqareaamsffrpslnqhglteqqwrvirilrqqgemesyqlanqacilrps
mtgvlarlerdgivrrwkapkdqrrvyvnltekgqqcfvsmsgdmeknyqriqerfgeek
laqllellnelkkikp

SCOPe Domain Coordinates for d2fbia1:

Click to download the PDB-style file with coordinates for d2fbia1.
(The format of our PDB-style files is described here.)

Timeline for d2fbia1: