Lineage for d2fbec_ (2fbe C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781734Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 1781746Protein Similar to Ret finger protein-like 1 [141157] (1 species)
  7. 1781747Species Human (Homo sapiens) [TaxId:9606] [141158] (1 PDB entry)
  8. 1781750Domain d2fbec_: 2fbe C: [133243]
    automated match to d2fbea1

Details for d2fbec_

PDB Entry: 2fbe (more details), 2.52 Å

PDB Description: Crystal Structure of the PRYSPRY-domain
PDB Compounds: (C:) PREDICTED: similar to ret finger protein-like 1

SCOPe Domain Sequences for d2fbec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbec_ b.29.1.22 (C:) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]}
gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
lsicsvinpsaasapvsse

SCOPe Domain Coordinates for d2fbec_:

Click to download the PDB-style file with coordinates for d2fbec_.
(The format of our PDB-style files is described here.)

Timeline for d2fbec_: