Lineage for d2fbeb1 (2fbe B:1-188)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664325Family b.29.1.22: SPRY domain [141154] (3 proteins)
    Pfam PF00622
  6. 664329Protein Similar to Ret finger protein-like 1 [141157] (1 species)
  7. 664330Species Human (Homo sapiens) [TaxId:9606] [141158] (1 PDB entry)
  8. 664332Domain d2fbeb1: 2fbe B:1-188 [133242]
    automatically matched to 2FBE A:1-188

Details for d2fbeb1

PDB Entry: 2fbe (more details), 2.52 Å

PDB Description: Crystal Structure of the PRYSPRY-domain
PDB Compounds: (B:) PREDICTED: similar to ret finger protein-like 1

SCOP Domain Sequences for d2fbeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbeb1 b.29.1.22 (B:1-188) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]}
gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
lsicsvin

SCOP Domain Coordinates for d2fbeb1:

Click to download the PDB-style file with coordinates for d2fbeb1.
(The format of our PDB-style files is described here.)

Timeline for d2fbeb1: