SCOP 1.73: Domain d2fbea1: 2fbe A:1-188

Lineage for d2fbea1 (2fbe A:1-188)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.22: SPRY domain [141154] (3 proteins)
   Pfam PF00622

6. Protein Similar to Ret finger protein-like 1 [141157] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141158] (1 PDB entry)

8. Domain d2fbea1: 2fbe A:1-188 [133241]

Details for d2fbea1

PDB Entry: 2fbe, 2.52 Å

PDB Description: Crystal Structure of the PRYSPRY-domain

PDB Compounds: (A:) PREDICTED: similar to ret finger protein-like 1

SCOP Domain Sequences for d2fbea1:

Sequence; same for both SEQRES and ATOM records:

>d2fbea1 b.29.1.22 (A:1-188) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]}
gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
lsicsvin

Timeline for d2fbea1:

• d2fbea1 is new in SCOP 1.73
  
• d2fbea1 appears in SCOP 1.75
  
• d2fbea1 appears in the current release, SCOPe 2.08