Lineage for d2fbaa_ (2fba A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004060Family a.102.1.1: Glucoamylase [48209] (2 protein domains)
    automatically mapped to Pfam PF00723
  6. 2004061Protein Glucoamylase [48210] (2 species)
  7. 2004069Species Yeast (Saccharomycopsis fibuligera) [TaxId:4944] [48212] (3 PDB entries)
  8. 2004070Domain d2fbaa_: 2fba A: [133239]
    automated match to d1ayx__
    complexed with trs

Details for d2fbaa_

PDB Entry: 2fba (more details), 1.1 Å

PDB Description: Glucoamylase from Saccharomycopsis fibuligera at atomic resolution
PDB Compounds: (A:) Glucoamylase GLU1

SCOPe Domain Sequences for d2fbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbaa_ a.102.1.1 (A:) Glucoamylase {Yeast (Saccharomycopsis fibuligera) [TaxId: 4944]}
aypsfeaysnykvdrtdletfldkqkevslyyllqniaypegqfnngvpgtviaspstsn
pdyyyqwtrdsaitfltvlselednnfnttlakaveyyintsynlqrtsnpsgsfddenh
kglgepkfntdgsaytgawgrpqndgpalrayaisrylndvnslnegklvltdsgdinfs
stediykniikpdleyvigywdstgfdlweenqgrhfftslvqqkalayavdiaksfddg
dfantlsstastlesylsgsdggfvntdvnhivenpdllqqnsrqgldsatyigpllthd
igessstpfdvdneyvlqsyylllednkdrysvnsaysagaaigrypedvyngdgssegn
pwflatayaaqvpyklaydaksasnditinkinydffnkyivdlstinsayqssdsvtik
sgsdefntvadnlvtfgdsflqvildhinddgslneqlnrytgystgaysltwssgalle
airlrnkvkala

SCOPe Domain Coordinates for d2fbaa_:

Click to download the PDB-style file with coordinates for d2fbaa_.
(The format of our PDB-style files is described here.)

Timeline for d2fbaa_: