![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.320: YojJ-like [143596] (1 superfamily) alpha-beta-X-beta-alpha-beta(2)-alpha-beta(3); 3 layers: a/b/a; 7-stranded mixed beta-sheet, order 2431567; strands 1 and 3 are parallel to each other |
![]() | Superfamily d.320.1: YojJ-like [143597] (1 family) ![]() |
![]() | Family d.320.1.1: YojJ-like [143598] (1 protein) Pfam PF02457; DUF147 |
![]() | Protein Hypothetical protein BC4920 (YojJ) [143599] (1 species) contains extra N-terminal hairpin of long helices; possible membrane spanning region |
![]() | Species Bacillus cereus [TaxId:1396] [143600] (1 PDB entry) Uniprot Q812L9 1-201 |
![]() | Domain d2fb5c2: 2fb5 C:5-205 [133237] Other proteins in same PDB: d2fb5a2, d2fb5b3, d2fb5c3 automated match to d2fb5a1 |
PDB Entry: 2fb5 (more details), 1.99 Å
SCOPe Domain Sequences for d2fb5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb5c2 d.320.1.1 (C:5-205) Hypothetical protein BC4920 (YojJ) {Bacillus cereus [TaxId: 1396]} mhewglseelkiqtkqmieiaekelsimrnaidkedecilckmedihhmlanvqtlaaty yiqaylspytesssfittaiqhlsarkhgalivvernetlealiqtgttlnahltaplle sifypgnplhdgavlvknnhivsaanilpltkstevdpelgtrhraaiglseksdalilv vseetgrtsfalngilytisl
Timeline for d2fb5c2:
![]() Domains from other chains: (mouse over for more information) d2fb5a1, d2fb5a2, d2fb5b2, d2fb5b3 |