Lineage for d2fb5a1 (2fb5 A:5-205)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741794Fold d.320: YojJ-like [143596] (1 superfamily)
    alpha-beta-X-beta-alpha-beta(2)-alpha-beta(3); 3 layers: a/b/a; 7-stranded mixed beta-sheet, order 2431567; strands 1 and 3 are parallel to each other
  4. 741795Superfamily d.320.1: YojJ-like [143597] (1 family) (S)
  5. 741796Family d.320.1.1: YojJ-like [143598] (1 protein)
    Pfam PF02457; DUF147
  6. 741797Protein Hypothetical protein BC4920 (YojJ) [143599] (1 species)
    contains extra N-terminal hairpin of long helices; possible membrane spanning region
  7. 741798Species Bacillus cereus [TaxId:1396] [143600] (1 PDB entry)
  8. 741799Domain d2fb5a1: 2fb5 A:5-205 [133235]

Details for d2fb5a1

PDB Entry: 2fb5 (more details), 1.99 Å

PDB Description: Structural Genomics; The crystal structure of the hypothetical membrane spanning protein from Bacillus cereus
PDB Compounds: (A:) hypothetical Membrane Spanning Protein

SCOP Domain Sequences for d2fb5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb5a1 d.320.1.1 (A:5-205) Hypothetical protein BC4920 (YojJ) {Bacillus cereus [TaxId: 1396]}
mhewglseelkiqtkqmieiaekelsimrnaidkedecilckmedihhmlanvqtlaaty
yiqaylspytesssfittaiqhlsarkhgalivvernetlealiqtgttlnahltaplle
sifypgnplhdgavlvknnhivsaanilpltkstevdpelgtrhraaiglseksdalilv
vseetgrtsfalngilytisl

SCOP Domain Coordinates for d2fb5a1:

Click to download the PDB-style file with coordinates for d2fb5a1.
(The format of our PDB-style files is described here.)

Timeline for d2fb5a1: