Lineage for d2fb3b_ (2fb3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449268Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) (S)
    common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel
  5. 2449278Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
    open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463
  6. 2449279Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)
  7. 2449280Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries)
    Uniprot P69848
  8. 2449286Domain d2fb3b_: 2fb3 B: [133234]
    automated match to d1tv7a_
    complexed with 5ad, gtp, met, pop, sf4, so4

Details for d2fb3b_

PDB Entry: 2fb3 (more details), 2.35 Å

PDB Description: Structure of MoaA in complex with 5'-GTP
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein A

SCOPe Domain Sequences for d2fb3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb3b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
qikdklgrpirdlrlsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctrarlssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq

SCOPe Domain Coordinates for d2fb3b_:

Click to download the PDB-style file with coordinates for d2fb3b_.
(The format of our PDB-style files is described here.)

Timeline for d2fb3b_: